PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G056900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 185aa    MW: 21090.7 Da    PI: 8.4893
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G056900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.54.2e-201562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd++l+++++ +G ++Wkt+a + g++R++k+c++rw++yl
  Phvul.002G056900.1 15 RGAWTAEEDQKLAQCIEIHGAKRWKTVAIKSGLNRCGKSCRLRWLNYL 62
                        89********************************************97 PP

2Myb_DNA-binding51.91.7e-1668112147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ + eE++l+ +++k+lG++ W++Ia++++ gRt++++k++w++ 
  Phvul.002G056900.1  68 RGNISVEEEDLITRLHKLLGNR-WSLIAKRLP-GRTDNEIKNYWNTC 112
                         78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0321066IPR017930Myb domain
SMARTSM007174.8E-161464IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-2914109IPR009057Homeodomain-like
PfamPF002496.6E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-231669IPR009057Homeodomain-like
CDDcd001671.89E-111762No hitNo description
PROSITE profilePS5129419.42467117IPR017930Myb domain
SMARTSM007175.1E-1467115IPR001005SANT/Myb domain
PfamPF002498.4E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2570117IPR009057Homeodomain-like
CDDcd001675.91E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MAPQNNETPK KTNNRGAWTA EEDQKLAQCI EIHGAKRWKT VAIKSGLNRC GKSCRLRWLN  60
YLRPNIKRGN ISVEEEDLIT RLHKLLGNRW SLIAKRLPGR TDNEIKNYWN TCLCKKVNHH  120
TKVKPETSMA QPTHSTQNTE EKVAAENKEG TDHDDGSGDS EVNFDVNEFF NFSIEGPYAL  180
DWVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-29151174105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-291411726128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-95AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516658.11e-115PREDICTED: transcription factor MYB32-like
SwissprotP102901e-49MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLK7K4Z01e-115K7K4Z0_SOYBN; Uncharacterized protein
STRINGGLYMA01G41610.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.12e-50myb domain protein 23